PDB entry 1fus

View 1fus on RCSB PDB site
Description: crystal structures of ribonuclease f1 of fusarium moniliforme in its free form and in complex with 2'gmp
Class: hydrolase(endoribonuclease)
Keywords: hydrolase(endoribonuclease)
Deposited on 1993-01-18, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease f1
    Species: Gibberella fujikuroi [TaxId:5127]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10282 (1-105)
      • conflict (31)
      • conflict (35)
    Domains in SCOPe 2.08: d1fusa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fusA (A:)
    esattcgstnysasqvraaanaacqyyqnddtagsstyphtynnyegfdfpvdgpyqefp
    iksggvytggspgadrvvintnceyagaithtgasgnnfvgcsgtn