PDB entry 1fur

View 1fur on RCSB PDB site
Description: fumarase mutant h188n with bound substrate l-malate at putative activator site
Class: hydrolyase
Keywords: hydrolyase, carbon oxygen lyase, kreb's cycle enzyme, fumarate hydratase
Deposited on 1997-01-09, released 1997-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.17
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fumarase c
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: FUMC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05042
      • engineered (187)
    Domains in SCOPe 2.07: d1fura_
  • Chain 'B':
    Compound: fumarase c
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: FUMC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05042 (0-End)
      • engineered (187)
    Domains in SCOPe 2.07: d1furb_
  • Heterogens: MLT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1furA (A:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrtnlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnv
    frpmvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydk
    aaeiakkahkegltlkaaalalgylseaefdswvrpeqmvgsmkagr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1furA (A:)
    vrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvnedlg
    llseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellggvrg
    merkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafadivk
    igrtnlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthpeya
    rrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlasgpr
    cgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrp
    mvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaae
    iakkahkegltlkaaalalgylseaefdswvrpeqm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1furB (B:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrtnlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnv
    frpmvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydk
    aaeiakkahkegltlkaaalalgylseaefdswvrpeqmvgsmkagr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1furB (B:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrtnlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepmpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrpm
    vihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaaei
    akkahkegltlkaaalalgylseaefdswvrpeqm