PDB entry 1fuq

View 1fuq on RCSB PDB site
Description: fumarase with bound 3-trimethylsilylsuccinic acid
Deposited on 1996-08-29, released 1997-03-12
The last revision prior to the SCOP 1.69 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1fuqa_
  • Chain 'B':
    Domains in SCOP 1.69: d1fuqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fuqA (A:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnv
    frpmvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydk
    aaeiakkahkegltlkaaalalgylseaefdswvrpeqmvgsmkagrhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fuqA (A:)
    vrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvnedlg
    llseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellggvrg
    merkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafadivk
    igrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthpeya
    rrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlasgpr
    cgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrp
    mvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaae
    iakkahkegltlkaaalalgylseaefdswvrpeqm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fuqB (B:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnv
    frpmvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydk
    aaeiakkahkegltlkaaalalgylseaefdswvrpeqmvgsmkagrhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fuqB (B:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepmpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrpm
    vihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaaei
    akkahkegltlkaaalalgylseaefdswvrpeqm