PDB entry 1fup

View 1fup on RCSB PDB site
Description: fumarase with bound pyromellitic acid
Class: lyase
Keywords: lyase, tricarboxylic acid cycle
Deposited on 1996-08-29, released 1997-03-12
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fumarase c
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fupa_
  • Chain 'B':
    Compound: fumarase c
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fupb_
  • Heterogens: MLT, PMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fupA (A:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnv
    frpmvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydk
    aaeiakkahkegltlkaaalalgylseaefdswvrpeqmvgsmkagrhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fupA (A:)
    rsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvnedlgl
    lseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellggvrgm
    erkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafadivki
    grthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthpeyar
    rvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlasgprc
    gigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrpm
    vihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaaei
    akkahkegltlkaaalalgylseaefdswvrpeqm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fupB (B:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnv
    frpmvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydk
    aaeiakkahkegltlkaaalalgylseaefdswvrpeqmvgsmkagrhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fupB (B:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepmpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrpm
    vihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaaei
    akkahkegltlkaaalalgylseaefdswvrpeqm