PDB entry 1fuo

View 1fuo on RCSB PDB site
Description: fumarase c with bound citrate
Class: lyase
Keywords: lyase, tricarboxylic acid cycle
Deposited on 1996-08-29, released 1997-03-12
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.165
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fumarase c
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fuoa_
  • Chain 'B':
    Compound: fumarase c
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fuob_
  • Heterogens: MLT, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fuoA (A:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnv
    frpmvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydk
    aaeiakkahkegltlkaaalalgylseaefdswvrpeqmvgsmkagr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fuoA (A:)
    vrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvnedlg
    llseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellggvrg
    merkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafadivk
    igrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthpeya
    rrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlasgpr
    cgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrp
    mvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaae
    iakkahkegltlkaaalalgylseaefdswvrpeqm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fuoB (B:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnv
    frpmvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydk
    aaeiakkahkegltlkaaalalgylseaefdswvrpeqmvgsmkagr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fuoB (B:)
    mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
    dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
    vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
    ivkigrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
    eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
    gprcgigeisipenepmpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrpm
    vihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaaei
    akkahkegltlkaaalalgylseaefdswvrpeqm