PDB entry 1fug

View 1fug on RCSB PDB site
Description: s-adenosylmethionine synthetase
Class: transferase
Keywords: transferase, one-carbon metabolism, ATP-binding, multigene family
Deposited on 1996-02-25, released 1996-08-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.21
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosylmethionine synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fuga1, d1fuga2, d1fuga3
  • Chain 'B':
    Compound: s-adenosylmethionine synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fugb1, d1fugb2, d1fugb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fugA (A:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdinqgvdradpleqgagdqg
    lmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgi
    davvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcg
    ltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsy
    aigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghf
    grehfpwektdkaqllrdaaglk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fugB (B:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdinqgvdradpleqgagdqg
    lmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgi
    davvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcg
    ltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsy
    aigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghf
    grehfpwektdkaqllrdaaglk