PDB entry 1fue

View 1fue on RCSB PDB site
Description: flavodoxin from helicobacter pylori
Class: electron transport
Keywords: flavoprotein, Helicobacter pylori, fmn, ELECTRON TRANSPORT
Deposited on 2000-09-15, released 2002-02-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZK53 (0-162)
      • see remark 999 (30)
      • see remark 999 (115)
      • see remark 999 (122)
      • see remark 999 (158)
    Domains in SCOPe 2.01: d1fuea_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fueA (A:)
    gkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfngftkvilvaptagagdlq
    tdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdgy
    hfaaskaveggkfvglvidednqddltderiakwveqvrgsfa