PDB entry 1fub

View 1fub on RCSB PDB site
Description: first protein structure determined from x-ray powder diffraction data
Class: hormone/growth factor
Keywords: powder diffraction, rietveld refinement, insulin
Deposited on 2000-09-14, released 2000-10-16
The last revision prior to the SCOP 1.73 freeze date was dated 2001-01-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.09 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin, a chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOP 1.73: d1fub.1
• Chain 'B':
  Compound: insulin, b chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOP 1.73: d1fub.1
• Chain 'C':
  Compound: insulin, a chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOP 1.73: d1fub.2
• Chain 'D':
  Compound: insulin, b chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOP 1.73: d1fub.2
• Heterogens: ZN, CL, NA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fubA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fubB (B:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fubC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fubD (D:)
  fvnqhlcgshlvealylvcgergffytpkt