PDB entry 1fu2
View 1fu2 on RCSB PDB site
Description: first protein structure determined from x-ray powder diffraction data
Class: hormone/growth factor
Keywords: powder diffraction, rietveld refinement, insulin, hormone-growth factor complex
Deposited on
2000-09-13, released
2000-10-16
The last revision prior to the SCOPe 2.03 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: PDIF
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.28
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: insulin, a chain
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1fu2.1 - Chain 'B':
Compound: insulin, b chain
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1fu2.1 - Chain 'C':
Compound: insulin, a chain
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1fu2.2 - Chain 'D':
Compound: insulin, b chain
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1fu2.2 - Chain 'E':
Compound: insulin, a chain
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1fu2.3 - Chain 'F':
Compound: insulin, b chain
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1fu2.3 - Chain 'G':
Compound: insulin, a chain
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1fu2.4 - Chain 'H':
Compound: insulin, b chain
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1fu2.4 - Heterogens: ZN, CL, NA
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1fu2A (A:)
giveqcctsicslyqlenycn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1fu2B (B:)
fvnqhlcgshlvealylvcgergffytpkt
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1fu2C (C:)
giveqcctsicslyqlenycn
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1fu2D (D:)
fvnqhlcgshlvealylvcgergffytpkt
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>1fu2E (E:)
giveqcctsicslyqlenycn
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>1fu2F (F:)
fvnqhlcgshlvealylvcgergffytpkt
- Chain 'G':
Sequence; same for both SEQRES and ATOM records: (download)
>1fu2G (G:)
giveqcctsicslyqlenycn
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>1fu2H (H:)
fvnqhlcgshlvealylvcgergffytpkt