PDB entry 1fu2

View 1fu2 on RCSB PDB site
Description: first protein structure determined from x-ray powder diffraction data
Class: hormone/growth factor
Keywords: powder diffraction, rietveld refinement, insulin, hormone-growth factor complex
Deposited on 2000-09-13, released 2000-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: PDIF
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin, a chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1fu2.1
• Chain 'B':
  Compound: insulin, b chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.08: d1fu2.1
• Chain 'C':
  Compound: insulin, a chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1fu2.2
• Chain 'D':
  Compound: insulin, b chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.08: d1fu2.2
• Chain 'E':
  Compound: insulin, a chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1fu2.3
• Chain 'F':
  Compound: insulin, b chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.08: d1fu2.3
• Chain 'G':
  Compound: insulin, a chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1fu2.4
• Chain 'H':
  Compound: insulin, b chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.08: d1fu2.4
• Heterogens: ZN, CL, NA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fu2A (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fu2B (B:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fu2C (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fu2D (D:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fu2E (E:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fu2F (F:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fu2G (G:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fu2H (H:)
  fvnqhlcgshlvealylvcgergffytpkt