PDB entry 1ftz

View 1ftz on RCSB PDB site
Description: nuclear magnetic resonance solution structure of the fushi tarazu homeodomain from drosophila and comparison with the antennapedia homeodomain
Deposited on 1994-01-07, released 1994-05-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1ftz__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ftz_ (-)
  mdskrtrqtytryqtlelekefhfnryitrrrridianalslserqikiwfqnrrmkskk
  drtldsspeh