PDB entry 1ftz

View 1ftz on RCSB PDB site
Description: nuclear magnetic resonance solution structure of the fushi tarazu homeodomain from drosophila and comparison with the antennapedia homeodomain
Class: DNA-binding
Keywords: DNA-binding
Deposited on 1994-01-07, released 1994-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fushi tarazu protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ftza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ftzA (A:)
    mdskrtrqtytryqtlelekefhfnryitrrrridianalslserqikiwfqnrrmkskk
    drtldsspeh