PDB entry 1ftx

View 1ftx on RCSB PDB site
Description: crystal structure of alanine racemase in complex with d-alanine phosphonate
Deposited on 2000-09-13, released 2003-01-14
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-14, with a file datestamp of 2003-01-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ftxA (A:)
    ndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasr
    lavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgp
    fpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyq
    ytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpypl
    keafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdg
    qkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctis
    yrvpriffrhkrimevrnai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ftxB (B:)
    ndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasr
    lavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgp
    fpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyq
    ytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpypl
    keafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdg
    qkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctis
    yrvpriffrhkrimevrnai