PDB entry 1ftt

View 1ftt on RCSB PDB site
Description: thyroid transcription factor 1 homeodomain (rattus norvegicus)
Class: DNA binding protein
Keywords: DNA binding protein, homeodomain, transcription factor
Deposited on 1995-10-03, released 1996-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thyroid transcription factor 1 homeodomain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RAT TTF-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ftta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fttA (A:)
    mrrkrrvlfsqaqvyelerrfkqqkylsaperehlasmihltptqvkiwfqnhrykmkrq
    akdkaaqq