PDB entry 1ftp

View 1ftp on RCSB PDB site
Description: three-dimensional structure of the muscle fatty-acid-binding protein isolated from the desert locust, schistocerca gregaria
Class: binding protein(fatty acid)
Keywords: binding protein(fatty acid)
Deposited on 1994-07-06, released 1994-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: muscle fatty acid binding protein
    Species: Schistocerca gregaria [TaxId:7010]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ftpa_
  • Chain 'B':
    Compound: muscle fatty acid binding protein
    Species: Schistocerca gregaria [TaxId:7010]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ftpb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ftpA (A:)
vkefagikykldsqtnfeeymkaigvgaierkaglalspvieleildgdkfkltsktaik
nteftfklgeefdeetldgrkvkstitqdgpnklvheqkgdhptiiirefskeqcvitik
lgdlvatriykaq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ftpB (B:)
vkefagikykldsqtnfeeymkaigvgaierkaglalspvieleildgdkfkltsktaik
nteftfklgeefdeetldgrkvkstitqdgpnklvheqkgdhptiiirefskeqcvitik
lgdlvatriykaq