PDB entry 1ftg

View 1ftg on RCSB PDB site
Description: structure of apoflavodoxin: closure of a tyrosine/tryptophan aromatic gate leads to a compact fold
Class: electron transport
Keywords: electron transport
Deposited on 1995-11-21, released 1996-12-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: apoflavodoxin
  Species: NOSTOC SP. [TaxId:1168]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A3E0 (0-167)
  Domains in SCOPe 2.01: d1ftga_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ftgA (A:)
  kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnige
  lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
  tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl