PDB entry 1fte

View 1fte on RCSB PDB site
Description: crystal structure of streptococcus pneumoniae acyl carrier protein synthase (native 1)
Class: transferase
Keywords: Acyl Carrier Protein Synthase, transferase
Deposited on 2000-09-12, released 2001-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl carrier protein synthase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A2W6
      • conflict (34)
    Domains in SCOPe 2.07: d1ftea_
  • Chain 'B':
    Compound: acyl carrier protein synthase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A2W6
      • conflict (34)
    Domains in SCOPe 2.07: d1fteb_
  • Chain 'C':
    Compound: acyl carrier protein synthase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A2W6 (2-End)
      • conflict (34)
    Domains in SCOPe 2.07: d1ftec_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fteA (A:)
    mrmivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsake
    afskamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvileenh
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fteA (A:)
    mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf
    skamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fteB (B:)
    mrmivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsake
    afskamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvileenh
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fteB (B:)
    mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf
    skamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fteC (C:)
    mrmivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsake
    afskamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvileenh
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fteC (C:)
    mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf
    skamgtgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee