PDB entry 1ftc

View 1ftc on RCSB PDB site
Description: y13c mutant of azotobacter vinelandii fdi
Class: electron transport
Keywords: electron transport, iron-sulfur
Deposited on 1997-01-08, released 1997-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.216
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00214 (0-105)
      • engineered (12)
    Domains in SCOPe 2.07: d1ftca_
  • Chain 'B':
    Compound: ferredoxin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00214 (0-105)
      • engineered (12)
    Domains in SCOPe 2.07: d1ftcb_
  • Heterogens: SF4, F3S

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ftcA (A:)
    afvvtdncikckctdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ftcB (B:)
    afvvtdncikckctdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler