PDB entry 1ftc

View 1ftc on RCSB PDB site
Description: y13c mutant of azotobacter vinelandii fdi
Deposited on 1997-01-08, released 1997-04-01
The last revision prior to the SCOP 1.55 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.216
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ftca_
  • Chain 'B':
    Domains in SCOP 1.55: d1ftcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ftcA (A:)
afvvtdncikckctdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ftcB (B:)
afvvtdncikckctdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler