PDB entry 1ft9

View 1ft9 on RCSB PDB site
Description: structure of the reduced (feii) co-sensing protein from r. rubrum
Class: transcription
Keywords: carbon monoxide, heme sensor, catabolite gene activator protein, transcription
Deposited on 2000-09-12, released 2000-10-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbon monoxide oxidation system transcription regulator
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ft9a1, d1ft9a2
  • Chain 'B':
    Compound: carbon monoxide oxidation system transcription regulator
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ft9b1, d1ft9b2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ft9A (A:)
    mpprfnianvllspdgetffrgfrskihakgslvctgegdengvfvvvdgrlrvylvgee
    reislfyltsgdmfcmhsgclveatertevrfadirtfeqklqtcpsmawgliailgral
    tscmrtiedlmfhdikqriagffidhanttgrqtqggvivsvdftveeianligssrqtt
    stalnslikegyisrqgrghytipnlvrlkaaadgdrddddd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ft9A (A:)
    pprfnianvllspdgetffrgfrskihakgslvctgegdengvfvvvdgrlrvylvgeer
    eislfyltsgdmfcmhsgclveatertevrfadirtfeqklqtcpsmawgliailgralt
    scmrtiedlmfhdikqriagffidhanttgrqtgvivsvdftveeianligssrqttsta
    lnslikegyisrqgrghytipnlvrlkaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ft9B (B:)
    mpprfnianvllspdgetffrgfrskihakgslvctgegdengvfvvvdgrlrvylvgee
    reislfyltsgdmfcmhsgclveatertevrfadirtfeqklqtcpsmawgliailgral
    tscmrtiedlmfhdikqriagffidhanttgrqtqggvivsvdftveeianligssrqtt
    stalnslikegyisrqgrghytipnlvrlkaaadgdrddddd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ft9B (B:)
    pprfnianvllspdgetffrgfrskihakgslvctgegdengvfvvvdgrlrvylvgeer
    eislfyltsgdmfcmhsgclveatertevrfadirtfeqklqtcpsmawgliailgralt
    scmrtiedlmfhdikqriagffidhanttgvivsvdftveeianligssrqttstalnsl
    ikegyisrqgrghytipnlvrlkaaa