PDB entry 1ft9

View 1ft9 on RCSB PDB site
Description: structure of the reduced (feii) co-sensing protein from r. rubrum
Deposited on 2000-09-12, released 2000-10-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-09, with a file datestamp of 2000-10-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ft9A (A:)
    pprfnianvllspdgetffrgfrskihakgslvctgegdengvfvvvdgrlrvylvgeer
    eislfyltsgdmfcmhsgclveatertevrfadirtfeqklqtcpsmawgliailgralt
    scmrtiedlmfhdikqriagffidhanttgrqtqggvivsvdftveeianligssrqtts
    talnslikegyisrqgrghytipnlvrlkaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ft9A (A:)
    pprfnianvllspdgetffrgfrskihakgslvctgegdengvfvvvdgrlrvylvgeer
    eislfyltsgdmfcmhsgclveatertevrfadirtfeqklqtcpsmawgliailgralt
    scmrtiedlmfhdikqriagffidhanttgrqtgvivsvdftveeianligssrqttsta
    lnslikegyisrqgrghytipnlvrlkaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ft9B (B:)
    pprfnianvllspdgetffrgfrskihakgslvctgegdengvfvvvdgrlrvylvgeer
    eislfyltsgdmfcmhsgclveatertevrfadirtfeqklqtcpsmawgliailgralt
    scmrtiedlmfhdikqriagffidhanttgrqtqggvivsvdftveeianligssrqtts
    talnslikegyisrqgrghytipnlvrlkaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ft9B (B:)
    pprfnianvllspdgetffrgfrskihakgslvctgegdengvfvvvdgrlrvylvgeer
    eislfyltsgdmfcmhsgclveatertevrfadirtfeqklqtcpsmawgliailgralt
    scmrtiedlmfhdikqriagffidhanttgvivsvdftveeianligssrqttstalnsl
    ikegyisrqgrghytipnlvrlkaaa