PDB entry 1ft7

View 1ft7 on RCSB PDB site
Description: aap complexed with l-leucinephosphonic acid
Class: hydrolase
Keywords: zinc, peptidase, bimetallic, HYDROLASE
Deposited on 2000-09-11, released 2000-10-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacterial leucyl aminopeptidase
    Species: Vibrio proteolyticus [TaxId:671]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ft7a_
  • Heterogens: ZN, K, PLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ft7A (A:)
    mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
    pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
    giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
    tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
    ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg