PDB entry 1ft3

View 1ft3 on RCSB PDB site
Description: crystal structure of truncated rhogdi k141a mutant
Class: signaling protein inhibitor
Keywords: immunoglobulin fold, beta sandwich motif, isoprenyl-binding domain, GDP-dissociation inhibitor of Rho GTPases, SIGNALING PROTEIN INHIBITOR
Deposited on 2000-09-11, released 2001-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rho GDP-dissociation inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52565 (1-End)
      • cloning artifact (0)
      • engineered (75)
    Domains in SCOPe 2.06: d1ft3a1, d1ft3a2
  • Chain 'B':
    Compound: rho GDP-dissociation inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52565 (1-End)
      • cloning artifact (0)
      • engineered (75)
    Domains in SCOPe 2.06: d1ft3b1, d1ft3b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ft3A (A:)
    mvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsg
    mkyiqhtyrkgvkidatdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd
    ktdhlswewnltikkdwkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ft3A (A:)
    mvpnvvvtgltlvcssapgpleldltsfvlkegveyrikisfrvnreivsgmkyiqhtyr
    kgvkidatdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswew
    nltikkdwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ft3B (B:)
    mvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsg
    mkyiqhtyrkgvkidatdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd
    ktdhlswewnltikkdwkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ft3B (B:)
    mvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsg
    mkyiqhtyrkgvkidatdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd
    ktdhlswewnltikkdwk