PDB entry 1ft2

View 1ft2 on RCSB PDB site
Description: co-crystal structure of protein farnesyltransferase complexed with a farnesyl diphosphate substrate
Class: transferase
Keywords: protein farnesyltransferase, farnesyl diphosphate, cancer therapeutics, prenyltransferase, isoprenoid
Deposited on 1998-06-02, released 1998-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.219
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein farnesyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ft2a_
  • Chain 'B':
    Compound: protein farnesyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ft2b_
  • Heterogens: ZN, FPP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ft2A (A:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhsr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ft2B (B:)
    plyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhy
    lkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfg
    ggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdv
    rsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvi
    lkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdp
    alsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgam
    lhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpg