PDB entry 1fsz

View 1fsz on RCSB PDB site
Description: crystal structure of the cell-division protein ftsz at 2.8a resolution
Class: cell-division protein
Keywords: ftsz, cell division protein, tubulin
Deposited on 1997-06-24, released 1998-06-24
The last revision prior to the SCOP 1.73 freeze date was dated 1998-06-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.199
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ftsz
    Species: Methanococcus jannaschii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fsza1, d1fsza2
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fszA (A:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipkigshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fszA (A:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiwgat
    idenlentvrvllvitgvqsrieftdtglkrkkl