PDB entry 1fsx

View 1fsx on RCSB PDB site
Description: the x-ray structure determination of bovine carbonmonoxy hb at 2.1 a resolution and its relationship to the quaternary structure of other hb crystal forms
Deposited on 2000-09-11, released 2001-06-06
The last revision prior to the SCOP 1.63 freeze date was dated 2001-06-06, with a file datestamp of 2001-06-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.205
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1fsxa_
  • Chain 'B':
    Domains in SCOP 1.63: d1fsxb_
  • Chain 'C':
    Domains in SCOP 1.63: d1fsxc_
  • Chain 'D':
    Domains in SCOP 1.63: d1fsxd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fsxA (A:)
    vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
    kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
    vhasldkflanvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fsxB (B:)
    mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
    ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
    ftpvlqadfqkvvagvanalahryh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fsxC (C:)
    vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
    kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
    vhasldkflanvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fsxD (D:)
    mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
    ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
    ftpvlqadfqkvvagvanalahryh