PDB entry 1fsp

View 1fsp on RCSB PDB site
Description: nmr solution structure of bacillus subtilis spo0f protein, 20 structures
Class: response regulator
Keywords: response regulator, sporulation, two-component systems, bacterial signal transduction, phospho-relay, (beta/alpha)5 protein
Deposited on 1997-06-05, released 1997-12-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stage 0 sporulation protein f
    Species: Bacillus subtilis [TaxId:1423]
    Gene: SPO0F
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fspa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fspA (A:)
    mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
    dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
    lksn