PDB entry 1fsk

View 1fsk on RCSB PDB site
Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1
Class: immune system
Keywords: Bet v 1, Bv16 Fab fragment, antibody allergen complex, IMMUNE SYSTEM
Deposited on 2000-09-11, released 2000-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.253
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fska_
  • Chain 'B':
    Compound: immunoglobulin kappa light chain
    Species: Mus musculus [TaxId:10090]
    Gene: BALB/C MICE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01837 (0-213)
      • conflict (3)
      • conflict (12)
      • conflict (21)
      • conflict (29)
      • conflict (33)
      • conflict (35)
      • conflict (40)
      • conflict (47)
      • conflict (50)
      • conflict (67)
      • conflict (90)
      • conflict (148)
    Domains in SCOPe 2.06: d1fskb1, d1fskb2
  • Chain 'C':
    Compound: antibody heavy chain fab
    Species: Mus musculus [TaxId:10090]
    Gene: BALB/C MICE
    Database cross-references and differences (RAF-indexed):
    • PDB 1FSK (0-219)
    Domains in SCOPe 2.06: d1fskc1, d1fskc2
  • Chain 'D':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fskd_
  • Chain 'E':
    Compound: immunoglobulin kappa light chain
    Species: Mus musculus [TaxId:10090]
    Gene: BALB/C MICE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01837 (0-213)
      • conflict (3)
      • conflict (12)
      • conflict (21)
      • conflict (29)
      • conflict (33)
      • conflict (35)
      • conflict (40)
      • conflict (47)
      • conflict (50)
      • conflict (67)
      • conflict (90)
      • conflict (148)
    Domains in SCOPe 2.06: d1fske1, d1fske2
  • Chain 'F':
    Compound: antibody heavy chain fab
    Species: Mus musculus [TaxId:10090]
    Gene: BALB/C MICE
    Database cross-references and differences (RAF-indexed):
    • PDB 1FSK (0-219)
    Domains in SCOPe 2.06: d1fskf1, d1fskf2
  • Chain 'G':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fskg_
  • Chain 'H':
    Compound: immunoglobulin kappa light chain
    Species: Mus musculus [TaxId:10090]
    Gene: BALB/C MICE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01837 (0-213)
      • conflict (3)
      • conflict (12)
      • conflict (21)
      • conflict (29)
      • conflict (33)
      • conflict (35)
      • conflict (40)
      • conflict (47)
      • conflict (50)
      • conflict (67)
      • conflict (90)
      • conflict (148)
    Domains in SCOPe 2.06: d1fskh1, d1fskh2
  • Chain 'I':
    Compound: antibody heavy chain fab
    Species: Mus musculus [TaxId:10090]
    Gene: BALB/C MICE
    Database cross-references and differences (RAF-indexed):
    • PDB 1FSK (0-219)
    Domains in SCOPe 2.06: d1fski1, d1fski2
  • Chain 'J':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fskj_
  • Chain 'K':
    Compound: immunoglobulin kappa light chain
    Species: Mus musculus [TaxId:10090]
    Gene: BALB/C MICE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01837 (0-213)
      • conflict (3)
      • conflict (12)
      • conflict (21)
      • conflict (29)
      • conflict (33)
      • conflict (35)
      • conflict (40)
      • conflict (47)
      • conflict (50)
      • conflict (67)
      • conflict (90)
      • conflict (148)
    Domains in SCOPe 2.06: d1fskk1, d1fskk2
  • Chain 'L':
    Compound: antibody heavy chain fab
    Species: Mus musculus [TaxId:10090]
    Gene: BALB/C MICE
    Database cross-references and differences (RAF-indexed):
    • PDB 1FSK (0-219)
    Domains in SCOPe 2.06: d1fskl1, d1fskl2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskA (A:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskB (B:)
    nivltqspksmsvsvgervtlsckasenvdtyvfwfqqkpdqspklllygpsnrytgvpd
    rftgsgsttdftltissvqaedladyhcgqsysypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskC (C:)
    qvqlqqpgtelvrpgasvilsckasgytftsywinwvkqrpgqglewvgnifpsdsytny
    nqkfkdkatltvdkssstaymqvnsptsedsavyyctrgardtwfaywgqgtlvtvsvak
    ttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskD (D:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskE (E:)
    nivltqspksmsvsvgervtlsckasenvdtyvfwfqqkpdqspklllygpsnrytgvpd
    rftgsgsttdftltissvqaedladyhcgqsysypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskF (F:)
    qvqlqqpgtelvrpgasvilsckasgytftsywinwvkqrpgqglewvgnifpsdsytny
    nqkfkdkatltvdkssstaymqvnsptsedsavyyctrgardtwfaywgqgtlvtvsvak
    ttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskG (G:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskH (H:)
    nivltqspksmsvsvgervtlsckasenvdtyvfwfqqkpdqspklllygpsnrytgvpd
    rftgsgsttdftltissvqaedladyhcgqsysypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskI (I:)
    qvqlqqpgtelvrpgasvilsckasgytftsywinwvkqrpgqglewvgnifpsdsytny
    nqkfkdkatltvdkssstaymqvnsptsedsavyyctrgardtwfaywgqgtlvtvsvak
    ttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskJ (J:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskK (K:)
    nivltqspksmsvsvgervtlsckasenvdtyvfwfqqkpdqspklllygpsnrytgvpd
    rftgsgsttdftltissvqaedladyhcgqsysypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskL (L:)
    qvqlqqpgtelvrpgasvilsckasgytftsywinwvkqrpgqglewvgnifpsdsytny
    nqkfkdkatltvdkssstaymqvnsptsedsavyyctrgardtwfaywgqgtlvtvsvak
    ttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc