PDB entry 1fsf

View 1fsf on RCSB PDB site
Description: glucosamine-6-phosphate deaminase from e.coli, t conformer, at 1.9a resolution
Class: isomerase
Keywords: allosteric enzyme, entropic effects, aldose-ketose isomerase, anisotropic refinement
Deposited on 2000-09-08, released 2002-01-04
The last revision prior to the SCOP 1.73 freeze date was dated 2002-01-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucosamine-6-phosphate deaminase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fsfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fsfA (A:)
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl