PDB entry 1fsb

View 1fsb on RCSB PDB site
Description: structure of the egf domain of p-selectin, nmr, 19 structures
Class: cell adhesion protein
Keywords: egf-like domain, cell adhesion protein, transmembrane, glycoprotein
Deposited on 1996-03-25, released 1997-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: p-selectin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16109 (0-39)
  Domains in SCOPe 2.08: d1fsba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fsbA (A:)
  tascqdmscskqgecletignytcscypgfygpeceyvre