PDB entry 1frt

View 1frt on RCSB PDB site
Description: crystal structure of the complex of rat neonatal fc receptor with fc
Deposited on 1994-11-11, released 1995-02-14
The last revision prior to the SCOP 1.71 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: -
Resolution: 4.5 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frtA (A:)
    aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
    wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
    rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlewke
    ppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfhaws
    llevkrgdehhyqcqveheglaqpltvdl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frtB (B:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frtC (C:)
    svflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyns
    tyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsreem
    tknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwq
    qgnvfscsvmhealhnhytqkslsl