PDB entry 1frt

View 1frt on RCSB PDB site
Description: crystal structure of the complex of rat neonatal fc receptor with fc
Class: complex (receptor/immunoglobulin)
Keywords: COMPLEX (RECEPTOR-IMMUNOGLOBULIN), COMPLEX (RECEPTOR-IMMUNOGLOBULIN) complex
Deposited on 1994-11-11, released 1995-02-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 4.5 Å
R-factor: 0.423
AEROSPACI score: -0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neonatal fc receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: BETA-2-MICROGLOBULIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1frta1, d1frta2
  • Chain 'B':
    Compound: beta 2-microglobulin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: BETA-2-MICROGLOBULIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1frtb_
  • Chain 'C':
    Compound: igg fc
    Species: Rattus norvegicus [TaxId:10116]
    Gene: BETA-2-MICROGLOBULIN
    Database cross-references and differences (RAF-indexed):
    • GB AAB21181 (0-204)
      • conflict (33)
      • conflict (44)
      • conflict (55)
      • conflict (73)
      • conflict (76)
      • conflict (117)
      • conflict (119)
    Domains in SCOPe 2.06: d1frtc1, d1frtc2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frtA (A:)
    aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
    wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
    rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlewke
    ppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfhaws
    llevkrgdehhyqcqveheglaqpltvdl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frtB (B:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frtC (C:)
    svflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyns
    tyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsreem
    tknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwq
    qgnvfscsvmhealhnhytqkslsl