PDB entry 1frn

View 1frn on RCSB PDB site
Description: the involvement of ser96 in the catalytic mechanism of ferredoxin-nadp+ reductase: structure-function relationship as studied by site-directed mutagenesis and x-ray crystallography
Deposited on 1995-03-31, released 1995-07-10
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.162
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frn_ (-)
    hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
    ipdgedkngkphklrlyviassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
    lkpgaevkltgpvgkemlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfngla
    wlflgvptsssllykeefekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavel
    wemlkkdntyfymcglkgmekgiddimvslaaaegidwieykrqlkkaeqwnvevy