PDB entry 1frl

View 1frl on RCSB PDB site
Description: azotobacter vinelandii ferredoxin I: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Class: electron transport
Keywords: electron transport
Deposited on 1993-09-27, released 1994-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.232
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferredoxin
  Species: Azotobacter vinelandii [TaxId:354]
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00214 (0-105)
    • conflict (37)
  Domains in SCOPe 2.07: d1frla_
• Heterogens: SF4, F3S, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1frlA (A:)
  afvvtdncikckytdcvevcpvdcfyegpnflvihpdscidcalcepecpaqaifsedev
  pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler