PDB entry 1frj

View 1frj on RCSB PDB site
Description: azotobacter vinelandii ferredoxin I: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Class: electron transport
Keywords: electron transport
Deposited on 1993-09-27, released 1994-08-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferredoxin
  Species: Azotobacter vinelandii
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00214 (0-105)
    • conflict (24)
  Domains in SCOP 1.73: d1frja_
• Heterogens: SF4, F3S, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1frjA (A:)
  afvvtdncikckytdcvevcpvdciyegpnflvihpdecidcalcepecpaqaifsedev
  pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler