PDB entry 1fri

View 1fri on RCSB PDB site
Description: azotobacter vinelandii ferredoxin I: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Class: electron transport
Keywords: electron transport
Deposited on 1993-09-27, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferredoxin
  Species: Azotobacter vinelandii [TaxId:354]
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00214 (0-105)
    • conflict (22)
  Domains in SCOPe 2.08: d1fria_
• Heterogens: SF4, F3S, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1friA (A:)
  afvvtdncikckytdcvevcpvncfyegpnflvihpdecidcalcepecpaqaifsedev
  pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler