PDB entry 1frh

View 1frh on RCSB PDB site
Description: azotobacter vinelandii ferredoxin I: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Class: electron transport
Keywords: electron transport
Deposited on 1993-09-27, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.224
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00214 (0-105)
      • conflict (1)
    Domains in SCOPe 2.08: d1frha_
  • Heterogens: SF4, F3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frhA (A:)
    ayvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler