PDB entry 1frg

View 1frg on RCSB PDB site
Description: crystal structure, sequence, and epitope mapping of a peptide complex of an anti-influenza ha peptide antibody fab 26(slash)9: fine-tuning antibody specificity
Deposited on 1994-01-17, released 1994-05-31
The last revision prior to the SCOP 1.69 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.19
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frgH (H:)
    evllvesggdlvkpggflklscaasgftfssfgmswvrhtpdkrlewvatisngggytyy
    qdsvkgrftisrdnakntlflemtslksedaglyycarrerydekgfaywgrgtlvtvsa
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frgL (L:)
    divmtqspssltvtagekvtmsckssqslfnsgkrknfltwyhqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltitsvqaedlaiyycqndyshpltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnr