PDB entry 1frg

View 1frg on RCSB PDB site
Description:
Deposited on 1994-01-17, released 1994-05-31
The last revision prior to the SCOP 1.65 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.19
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1frgh1, d1frgh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1frgl1, d1frgl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frgH (H:)
    evllvesggdlvkpggflklscaasgftfssfgmswvrhtpdkrlewvatisngggytyy
    qdsvkgrftisrdnakntlflemtslksedaglyycarrerydekgfaywgrgtlvtvsa
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frgL (L:)
    divmtqspssltvtagekvtmsckssqslfnsgkrknfltwyhqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltitsvqaedlaiyycqndyshpltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnr