PDB entry 1frg

View 1frg on RCSB PDB site
Description: crystal structure, sequence, and epitope mapping of a peptide complex of an anti-influenza ha peptide antibody fab 26(slash)9: fine-tuning antibody specificity
Class: Viral protein/Immune system
Keywords: IMMUNOGLOBULIN/VIRUS HEMAGGLUTININ, Viral protein-Immune system COMPLEX
Deposited on 1994-01-17, released 1994-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.19
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a 26/9 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA38230 (0-219)
      • conflict (2)
      • conflict (16)
      • conflict (27)
      • conflict (31)
      • conflict (38)
      • conflict (60)
      • conflict (79)
      • conflict (81)
      • conflict (83)
      • conflict (90-92)
      • conflict (104)
      • conflict (111)
      • insertion (218)
    Domains in SCOPe 2.07: d1frgh1, d1frgh2
  • Chain 'L':
    Compound: igg2a 26/9 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR A31790 (0-216)
      • conflict (23)
      • conflict (34)
      • conflict (37)
      • conflict (42)
      • conflict (51)
      • conflict (68)
      • conflict (81)
      • conflict (90)
      • conflict (99)
      • conflict (105)
    Domains in SCOPe 2.07: d1frgl1, d1frgl2
  • Chain 'P':
    Compound: influenza hemagglutinin ha1 (strain x47) (residues 101 - 108)
    Database cross-references and differences (RAF-indexed):
    • PDB 1FRG
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frgH (H:)
    evllvesggdlvkpggflklscaasgftfssfgmswvrhtpdkrlewvatisngggytyy
    qdsvkgrftisrdnakntlflemtslksedaglyycarrerydekgfaywgrgtlvtvsa
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frgL (L:)
    divmtqspssltvtagekvtmsckssqslfnsgkrknfltwyhqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltitsvqaedlaiyycqndyshpltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'P':
    No sequence available.