PDB entry 1frd

View 1frd on RCSB PDB site
Description: molecular structure of the oxidized, recombinant, heterocyst (2fe-2s) ferredoxin from anabaena 7120 determined to 1.7 angstroms resolution
Deposited on 1993-04-14, released 1994-05-31
The last revision prior to the SCOP 1.63 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.167
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1frd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frd_ (-)
    asyqvrlinkkqdidttieideettildgaeengielpfschsgscsscvgkvvegevdq
    sdqiflddeqmgkgfallcvtyprsnctikthqepyla