PDB entry 1fra

View 1fra on RCSB PDB site
Description: tertiary structure of erabutoxin b in aqueous solution elucidated by two-dimensional nuclear magnetic resonance
Class: toxin
Keywords: toxin
Deposited on 1994-03-28, released 1994-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: erabutoxin b
    Species: Laticauda semifasciata [TaxId:8631]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fraa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fraA (A:)
    ricfnhqssqpqttktcspgesscyhkqwsdfrgtiiergcgcptvkpgiklsccesevc
    nn