PDB entry 1fr5

View 1fr5 on RCSB PDB site
Description: phage fr capsids with a four residue deletion in the coat protein fg loop
Class: Virus
Keywords: VIRAL COAT PROTEIN, CAPSID, Icosahedral virus
Deposited on 1998-07-22, released 1999-01-13
The last revision prior to the SCOP 1.73 freeze date was dated 1999-01-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.256
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriophage fr capsid
    Species: Bacteriophage fr
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fr5a_
  • Chain 'B':
    Compound: bacteriophage fr capsid
    Species: Bacteriophage fr
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fr5b_
  • Chain 'C':
    Compound: bacteriophage fr capsid
    Species: Bacteriophage fr
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fr5c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fr5A (A:)
    asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
    kvevpkvatgvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaa
    nsgiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fr5B (B:)
    asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
    kvevpkvatgvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaa
    nsgiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fr5B (B:)
    asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
    kvevpkvawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaansgiy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fr5C (C:)
    asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
    kvevpkvatgvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaa
    nsgiy