PDB entry 1fr5

View 1fr5 on RCSB PDB site
Description: phage fr capsids with a four residue deletion in the coat protein fg loop
Deposited on 1998-07-22, released 1999-01-13
The last revision prior to the SCOP 1.71 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.256
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1fr5a_
  • Chain 'B':
    Domains in SCOP 1.71: d1fr5b_
  • Chain 'C':
    Domains in SCOP 1.71: d1fr5c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fr5A (A:)
    asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
    kvevpkvatgvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaa
    nsgiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fr5B (B:)
    asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
    kvevpkvatgvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaa
    nsgiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fr5B (B:)
    asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
    kvevpkvawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaansgiy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fr5C (C:)
    asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
    kvevpkvatgvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaa
    nsgiy