PDB entry 1fq9

View 1fq9 on RCSB PDB site
Description: crystal structure of a ternary fgf2-fgfr1-heparin complex
Deposited on 2000-09-04, released 2000-09-27
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-27, with a file datestamp of 2000-09-27.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.229
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fq9A (A:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fq9B (B:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fq9C (C:)
    mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
    ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpanktva
    lgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttdkemevlhl
    rnvsfedageytclagnsiglshhsawltvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fq9D (D:)
    mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
    ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpanktva
    lgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttdkemevlhl
    rnvsfedageytclagnsiglshhsawltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fq9D (D:)
    mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
    ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpanktva
    lgsnvefmckvysdpqphiqwlkhvqilktagvnttdkemevlhlrnvsfedageytcla
    gnsiglshhsawltvl