PDB entry 1fq9

View 1fq9 on RCSB PDB site
Description: crystal structure of a ternary fgf2-fgfr1-heparin complex
Class: growth factor/growth factor receptor
Keywords: I-set subgroup within the immunoglobulin superfamily, b-trefoil fold, GROWTH FACTOR-GROWTH FACTOR RECEPTOR COMPLEX
Deposited on 2000-09-04, released 2000-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.229
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • engineered (54)
      • engineered (72)
    Domains in SCOPe 2.07: d1fq9a_
  • Chain 'B':
    Compound: fibroblast growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • engineered (54)
      • engineered (72)
    Domains in SCOPe 2.07: d1fq9b_
  • Chain 'C':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered (44)
    Domains in SCOPe 2.07: d1fq9c1, d1fq9c2
  • Chain 'D':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered (44)
    Domains in SCOPe 2.07: d1fq9d1, d1fq9d2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fq9A (A:)
    ghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryl
    amkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgq
    kailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fq9A (A:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fq9B (B:)
    ghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryl
    amkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgq
    kailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fq9B (B:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fq9C (C:)
    tdntkpnrmpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpd
    hriggykvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqag
    lpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttd
    kemevlhlrnvsfedageytclagnsiglshhsawltvlealeer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fq9C (C:)
    mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
    ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpanktva
    lgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttdkemevlhl
    rnvsfedageytclagnsiglshhsawltvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fq9D (D:)
    tdntkpnrmpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpd
    hriggykvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqag
    lpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttd
    kemevlhlrnvsfedageytclagnsiglshhsawltvlealeer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fq9D (D:)
    mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
    ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpanktva
    lgsnvefmckvysdpqphiqwlkhvqilktagvnttdkemevlhlrnvsfedageytcla
    gnsiglshhsawltvl