PDB entry 1fq4

View 1fq4 on RCSB PDB site
Description: crystal structure of a complex between hydroxyethylene inhibitor cp-108,420 and yeast aspartic proteinase a
Class: hydrolase/hydrolase inhibitor
Keywords: Aspartic proteinase-inhibitor complex, extended beta-strand (inhibitor), HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2000-09-03, released 2000-09-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.17
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: saccharopepsin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07267 (0-328)
      • conflict (317)
    Domains in SCOPe 2.04: d1fq4a_
  • Heterogens: 2Y2, NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fq4A (A:)
    gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
    asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
    ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
    gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
    kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
    laivgdaflrkyysiydignnavglakai