PDB entry 1fq4

View 1fq4 on RCSB PDB site
Description: crystal structure of a complex between hydroxyethylene inhibitor cp- 108,420 and yeast aspartic proteinase a
Deposited on 2000-09-03, released 2000-09-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-15, with a file datestamp of 2000-11-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.17
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1fq4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fq4A (A:)
    gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
    asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
    ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
    gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
    kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
    laivgdaflrkyysiydignnavglakai