PDB entry 1fq3

View 1fq3 on RCSB PDB site
Description: crystal structure of human granzyme b
Class: hydrolase
Keywords: chymotrypsin-like serine proteinase, HYDROLASE
Deposited on 2000-09-03, released 2001-01-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: granzyme b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1fq3a_
  • Chain 'B':
    Compound: granzyme b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1fq3b_
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fq3A (A:)
    iiggheakphsrpymaylmiwdqkslkrcggfliqddfvltaahcwgssinvtlgahnik
    eqeptqqfipvkrpiphpaynpknfsndimllqlerkakrtravqplrlpsnkaqvkpgq
    tcsvagwgqtaplgkhshtlqevkmtvqedrkcesdlrhyydstielcvgdpeikktsfk
    gdsggplvcnkvaqgivsygrnngmppractkvssfvhwikktmkry
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fq3B (B:)
    iiggheakphsrpymaylmiwdqkslkrcggfliqddfvltaahcwgssinvtlgahnik
    eqeptqqfipvkrpiphpaynpknfsndimllqlerkakrtravqplrlpsnkaqvkpgq
    tcsvagwgqtaplgkhshtlqevkmtvqedrkcesdlrhyydstielcvgdpeikktsfk
    gdsggplvcnkvaqgivsygrnngmppractkvssfvhwikktmkry