PDB entry 1fpz

View 1fpz on RCSB PDB site
Description: crystal structure analysis of kinase associated phosphatase (kap) with a substitution of the catalytic site cysteine (cys140) to a serine
Deposited on 2000-09-01, released 2001-05-09
The last revision prior to the SCOP 1.63 freeze date was dated 2001-05-09, with a file datestamp of 2001-05-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1fpza_
  • Chain 'B':
    Domains in SCOP 1.63: d1fpzb_
  • Chain 'C':
    Domains in SCOP 1.63: d1fpzc_
  • Chain 'D':
    Domains in SCOP 1.63: d1fpzd_
  • Chain 'E':
    Domains in SCOP 1.63: d1fpze_
  • Chain 'F':
    Domains in SCOP 1.63: d1fpzf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpzA (A:)
    tpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfctrgel
    skyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihsyggl
    grsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpzB (B:)
    tpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfctrgel
    skyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihsyggl
    grsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpzC (C:)
    eqtpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfctrg
    elskyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihsyg
    glgrsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpzD (D:)
    eqtpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfctrg
    elskyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihsyg
    glgrsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpzE (E:)
    tpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfctrgel
    skyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihsyggl
    grsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpzF (F:)
    eqtpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfctrg
    elskyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihsyg
    glgrsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl